DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG8170

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:317 Identity:79/317 - (24%)
Similarity:131/317 - (41%) Gaps:58/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QGCESG--QTCCPKT----------------EILQYPVQ----ADNQPLPTECGHVNRIGVGFTI 98
            ||...|  :.||.:|                ::...|.:    .:|:|   .||          |
  Fly   550 QGTCDGLLRGCCHRTAKSANLGSSDFVGNAVDLTDLPQKNYGPVNNEP---SCG----------I 601

  Fly    99 TNARDIAQK----------GELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIV 153
            :.|:..||:          |..||...:....||.   |||||:|..|:|:.........:.:.|
  Fly   602 SLAKQTAQRRIVGGDDAGFGSFPWQAYIRIGSSRC---GGSLISRRHVVTAGHCVARATPRQVHV 663

  Fly   154 RAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGAN--NAALLFLARPLKLDHHIGLICLPPPN 216
            ..|::...|..|........:|:|..|........|:  :.::|.|.|.:....||..||||..|
  Fly   664 TLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKN 728

  Fly   217 RNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG-GE 280
            .:|:......:|||............|:.:::|:::..:|: :.....|.:.::...::||| ..
  Fly   729 EDFLGKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRICE-RWHRQNGINVVIYQEMLCAGYRN 792

  Fly   281 PGKDTCKGDGGAPLACPLQSDPN-RYELLGIVNFGFGCGG-PLPAAYTDVSQIRSWI 335
            .|||:|:||.|.    ||..|.| |:.|:|:|:.|:.|.. ..|..|..||:...|:
  Fly   793 GGKDSCQGDSGG----PLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 66/246 (27%)
Tryp_SPc 105..335 CDD:214473 65/244 (27%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 63/241 (26%)
Tryp_SPc 612..846 CDD:238113 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.