DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG8586

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:342 Identity:123/342 - (35%)
Similarity:179/342 - (52%) Gaps:33/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CGGSMAKECVQRNRCR--IGTETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLP 83
            ||.:|  |||.|..||  |..::|..:|:.|  .:..|..:|...||...:      :.|:...|
  Fly   105 CGQNM--ECVPRKLCRDNIINDSGISLINPR--ISPIQCSKSLYRCCAVDQ------KVDDSESP 159

  Fly    84 ----------TECGHVNRIGV---GFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDV 135
                      ..||:.|..|:   ......:.|::..||.||||.:...|... |.||:||...:
  Fly   160 YLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEF-LCGGTLIHPRL 223

  Fly   136 VLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARP 200
            |:|:|...:......|:.|||:||..|:.|...|:...|::|:.|:.....:..|:.|||.|..|
  Fly   224 VVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEP 288

  Fly   201 LKLDHHIGLICLPPPNRNFIHNR-----CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKL 260
            ::|..||..:|||||....:.|:     |..:|||.|.|..:...::||:|.||||:|..||.||
  Fly   289 IRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKL 353

  Fly   261 QGP-YGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPA 323
            :.. ....|.|..|.|||||:|||||||||||:||.|.:..:.:||:|:|||::|..|. ..:||
  Fly   354 RNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPA 418

  Fly   324 AYTDVSQIRSWIDNCIQ 340
            .|.:|..:|.|||..|:
  Fly   419 VYVNVPHLRGWIDEKIR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 97/238 (41%)
Tryp_SPc 105..335 CDD:214473 95/236 (40%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 98/236 (42%)
Tryp_SPc 197..430 CDD:214473 95/233 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.