DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and SPH93

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:310 Identity:123/310 - (39%)
Similarity:169/310 - (54%) Gaps:33/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IGTET---GRPIIDF-RGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGV--- 94
            :|..|   |.|..:| ...|||..         |.|.:      ..::.|...||..|..|:   
  Fly   195 VGNPTNNGGNPTTNFGNPTNNGGN---------PTTNV------GSSELLSPSCGMSNANGLQMV 244

  Fly    95 -GFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEW 158
             |.||    |.|:..:.||.||:..:...  |.|||||..:||||.:.:.:.: |..|:||||:|
  Fly   245 EGITI----DQARPAQYPWAVAIFHNGQY--LAGGSLIQPNVVLTVAHRVITI-ETELVVRAGDW 302

  Fly   159 DFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR 223
            |.:|..|....|...:.:.|.|.....::||||.|||||..|.||:.||..||||.||::|...|
  Fly   303 DLKSDREIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRR 367

  Fly   224 CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGP-YGKDFILDNSLICAGGEPGKDTCK 287
            |.|:||||....|..|..:|||::|.:|:|:||:..|:.. .|..|.|..::||||||.|:|||.
  Fly   368 CTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGRDTCT 432

  Fly   288 GDGGAPLACPLQSDPNR-YELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            ||||:.|.|.:..:.:. ||..||||:|.|||.. :||.||:||:..:||
  Fly   433 GDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 104/234 (44%)
Tryp_SPc 105..335 CDD:214473 102/232 (44%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 105/236 (44%)
Tryp_SPc 252..482 CDD:214473 102/232 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471547
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.