DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG18478

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:268 Identity:112/268 - (41%)
Similarity:161/268 - (60%) Gaps:10/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ECGHVN--RIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVP 147
            :||:.|  .:.|.|.:|..:  |:..|.||.:|::.:||.  :|||||||.|:|||::.:.....
  Fly    30 KCGYGNPDAVKVQFNVTEGQ--AKPAEFPWTIAVIHNRSL--VGGGSLITPDIVLTAAHRIFNKD 90

  Fly   148 EKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICL 212
            .:.::|.||||::.|..|:...|:..:.|:|.|.:.:.:.||||.|||||.|...|.:.|..|||
  Fly    91 VEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICL 155

  Fly   213 PPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGP-YGKDFILDNSLIC 276
            |...|:....||||:||||....|..|..:||||:||:|.|.:||.:|:.. .|:::.|...|||
  Fly   156 PTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLIC 220

  Fly   277 AGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQ 340
            ||||...|.|.||||..|.||:..||.::|.:||||:|.||... :||.||||.:.:.||...|:
  Fly   221 AGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIK 285

  Fly   341 AEAVHYSP 348
            ...  |:|
  Fly   286 ENL--YTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 103/233 (44%)
Tryp_SPc 105..335 CDD:214473 101/231 (44%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 103/234 (44%)
Tryp_SPc 50..280 CDD:214473 101/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471535
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.