DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:292 Identity:87/292 - (29%)
Similarity:135/292 - (46%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TEILQYPVQ-ADNQPLPTECGHVNRIGVGFTITNARDI----AQKGELPWMVALLDSRSRLPLGG 127
            |...:.||. ..::.||.:||:.|.:    |....|.:    |...|.||:..|..|..:  ..|
  Fly   368 TTTTRRPVSGTSSEGLPLQCGNKNPV----TPDQERIVGGINASPHEFPWIAVLFKSGKQ--FCG 426

  Fly   128 GSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITE-----------ERAHEDVAIRKIVRHT 181
            |||||...:||::         :.:.|...||..::|.           |..|....|:::|||.
  Fly   427 GSLITNSHILTAA---------HCVARMTSWDVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHK 482

  Fly   182 NLSVENGANNAALLFLARPLKLDHHIGLICLP----PPNRNFIHNRCIVSGWGKKTALDNSYMNI 242
            ........|:.|:|.|:.|:.....|..||||    ..:|::......|:|||.... :....:|
  Fly   483 GFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVAGWGSLRE-NGPQPSI 546

  Fly   243 LKKIELPLVDRSVCQTKLQGPYGK---DFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNR 304
            |:|:::|:...:.|..|    ||:   ..|:: |:||| |:..||:|.||.|.|:..   :|..|
  Fly   547 LQKVDIPIWTNAECARK----YGRAAPGGIIE-SMICA-GQAAKDSCSGDSGGPMVI---NDGGR 602

  Fly   305 YELLGIVNFGFGCG-GPLPAAYTDVSQIRSWI 335
            |..:|||::|.||| |..|..||.|:.:..||
  Fly   603 YTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWI 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 77/250 (31%)
Tryp_SPc 105..335 CDD:214473 75/248 (30%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 76/255 (30%)
Tryp_SPc 400..637 CDD:238113 77/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.