DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and OVCH2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_016873148.1 Gene:OVCH2 / 341277 HGNCID:29970 Length:569 Species:Homo sapiens


Alignment Length:306 Identity:79/306 - (25%)
Similarity:129/306 - (42%) Gaps:65/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS--------TKTLEVPEKYLIVRAGEWDFES 162
            :||..||.|:|...:..  :.|||:::...|:|::        ..||.       |.|||:|...
Human    63 EKGSYPWQVSLKQRQKH--ICGGSIVSPQWVITAAHCIANRNIVSTLN-------VTAGEYDLSQ 118

  Fly   163 ITEERAHEDVAIRKIVRHTNLSVENGAN-NAALLFLARPLKLDHHIGLICLPPPNRNFIHN-RCI 225
              .:...:.:.|..::.|.:.|.:...: :.|||.:|...:..|.:|.||||.....|... .|.
Human   119 --TDPGEQTLTIETVIIHPHFSTKKPMDYDIALLKMAGAFQFGHFVGPICLPELREQFEAGFICT 181

  Fly   226 VSGWGKKTALDNSYMNILKKIELPLVDRSVCQT---KLQGPY-GKDFILDNSLICAG-GEPGKDT 285
            .:|||:.|. ......:|:::.||::....|..   .|:.|. ||.|      :|.| .:.|:|.
Human   182 TAGWGRLTE-GGVLSQVLQEVNLPILTWEECVAALLTLKRPISGKTF------LCTGFPDGGRDA 239

  Fly   286 CKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG------------GPLPAAYTDVSQIRSWIDNC 338
            |:||.|..|.|  ::....:.|.|:.::|.|||            |. |..:||:|::..||   
Human   240 CQGDSGGSLMC--RNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGS-PGIFTDISKVLPWI--- 298

  Fly   339 IQAEAVHYSPQLGNVGQSPAPLDRYIPNIGLETQNEVHSPVQGSLH 384
                  |...|.||..:|        .......|:.:.|..:|.||
Human   299 ------HEHIQTGNRRKS--------SRAWCSEQDVIVSGAEGKLH 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/257 (27%)
Tryp_SPc 105..335 CDD:214473 67/255 (26%)
OVCH2XP_016873148.1 Tryp_SPc 55..298 CDD:214473 67/255 (26%)
Tryp_SPc 56..301 CDD:238113 70/267 (26%)
CUB 320..424 CDD:238001 4/11 (36%)
CUB 435..546 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.