DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG31954

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:230 Identity:77/230 - (33%)
Similarity:119/230 - (51%) Gaps:22/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVA 173
            :.|..|:|..|..   :.|||:|:.:.:||::..|.......|.||.|..:|     .|:.:.:.
  Fly    61 DAPHQVSLQTSSH---ICGGSIISEEWILTAAHCTYGKTADRLKVRLGTSEF-----ARSGQLLR 117

  Fly   174 IRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR-CIVSGWGKKTALDN 237
            ::|||:|...:..|...:.:||.||.|:|.|.....:.||.....::... |.|||||....|..
  Fly   118 VQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLE 182

  Fly   238 SYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSD 301
            | ...|:::|:|||::.:|..|.: .||.   :...:||||. |.|||.|:||.|.|:.    |:
  Fly   183 S-REWLRQVEVPLVNQELCSEKYK-QYGG---VTERMICAGFLEGGKDACQGDSGGPMV----SE 238

  Fly   302 PNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            ..  ||:|:|::|:||..| .|..|:.||..|.||
  Fly   239 SG--ELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 77/230 (33%)
Tryp_SPc 105..335 CDD:214473 75/228 (33%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 75/228 (33%)
Tryp_SPc 51..274 CDD:238113 77/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.