DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG40160

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:337 Identity:125/337 - (37%)
Similarity:185/337 - (54%) Gaps:27/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGSMAKECVQRNRCRIGTET--------GRPIIDFRGLNNGNQGC-ESGQTCCPKTEILQ---YP 74
            |.:....||...:|...|::        |..:||.| .|:.:..| .|...||.....|.   .|
  Fly    75 GKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIR-FNDDDPICPASVDVCCDANRTLNKTLNP 138

  Fly    75 VQADNQP-LPTECGHVNRIGVGFTITN-ARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVL 137
            ...|.:| .|..||..|..|:.||::. :::.|..||.||.||||.|.:......||||.:.|||
  Fly   139 TPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVL 203

  Fly   138 TSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLK 202
            |::.....:......|||||||.:::.|...:::.:::.::.|.:.:..:.|.:.||:.|::|:.
  Fly   204 TAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVT 268

  Fly   203 LDHHIGLICLPP----PNRNFIHNRCIVSGWGKKT--ALDNSYMNILKKIELPLVDRSVCQTKLQ 261
            ||.||.:||||.    |...   |.|..:||||..  :| ..|.:::|::.||:|:.:.|||:|:
  Fly   269 LDDHINVICLPQQDDIPQPG---NTCFSTGWGKDAFGSL-GKYSSLMKRVPLPIVEFNSCQTRLR 329

  Fly   262 GP-YGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSD-PNRYELLGIVNFGFGCGGPLPAA 324
            |. .|..|.||.|.|||||:.|.|||:||||||||||..|. .:||:..|||.:|.||...:|||
  Fly   330 GTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDEVPAA 394

  Fly   325 YTDVSQIRSWID 336
            |.:|:.:|.|||
  Fly   395 YANVALVRGWID 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 100/240 (42%)
Tryp_SPc 105..335 CDD:214473 97/237 (41%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 100/245 (41%)
Tryp_SPc 169..405 CDD:214473 97/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.