DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and prss60.3

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:292 Identity:86/292 - (29%)
Similarity:128/292 - (43%) Gaps:43/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TC-------CPKTEILQYPVQADNQPLPTE-CGHVNRIGVGFTITNARDIAQKGELPWMVALLDS 119
            ||       |.|..:.|..| ....||.|. .|.||              |..|..||.|:|...
Zfish     7 TCATLTLLICVKGSLSQLNV-CGQAPLNTRIVGGVN--------------ASPGSWPWQVSLHSP 56

  Fly   120 RSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLS 184
            :......|||||:.:.|||::.....|.|..|:|..|....:.|.......:||  |...|::.:
Zfish    57 KYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQGINIYETSRNVA--KSFVHSSYN 119

  Fly   185 VENGANNAALLFLARPLKLDHHIGLICLPPPNRNF-IHNRCIVSGWGK-KTALDNSYMNILKKIE 247
            .....|:.|||.|:..:...::|..:||...|..: ......::|||. :..::.....||::..
Zfish   120 SNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETM 184

  Fly   248 LPLVDRSVCQTKLQGPYGKDFILDNSLICAG-GEPGKDTCKGDGGAPLA---CPLQSDPNRYELL 308
            :|:|....|...|    |...: .|::|||| .:.|||||:||.|.|:.   |.:      :...
Zfish   185 IPVVANDRCNALL----GSGTV-TNNMICAGLTQGGKDTCQGDSGGPMVTRLCTV------WVQA 238

  Fly   309 GIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCI 339
            ||.::|:||..| .|..||.|||.:|||.:.|
Zfish   239 GITSWGYGCADPNSPGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/238 (31%)
Tryp_SPc 105..335 CDD:214473 71/236 (30%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 76/259 (29%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.