DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Ser6

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:106/279 - (37%) Gaps:69/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLE 145
            |:.:..|.:|...||      .:.|.|.:.|..|:|.::.|.  ..|||::||..:||::.....
  Fly    20 PVQSAPGKLNGRVVG------GEDAVKNQFPHQVSLRNAGSH--SCGGSILTRTYILTAAHCVSN 76

  Fly   146 VPEKYLI---------VRAGEWD------FESITEERAHEDVAIRKIVRHTNLSVENGANNAALL 195
            ....::|         :|||..|      ...:.|...||:..             |..|:.|||
  Fly    77 EDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG-------------NFLNDVALL 128

  Fly   196 FLARPLKLDHHIGLICLP----PPNRNFIHNRCIVSGWGK-KTALD-NSYM--NILKKIELPLVD 252
            .|..||.|...|..|.||    |.:.:     .::||||: |...| ..|:  |.||.|     .
  Fly   129 RLESPLILSASIQPIDLPTVDTPADVD-----VVISGWGRIKHQGDLPRYLQYNTLKSI-----T 183

  Fly   253 RSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF-G 316
            |..|:..:      ||..:..| |...:.....|.||.|.|..       ...:|:|:..|.. |
  Fly   184 RQQCEELI------DFGFEGEL-CLLHQVDNGACNGDSGGPAV-------YNNQLVGVAGFVVDG 234

  Fly   317 CGGPLPAAYTDVSQIRSWI 335
            ||...|..|..|...:.||
  Fly   235 CGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 68/255 (27%)
Tryp_SPc 105..335 CDD:214473 66/253 (26%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 68/266 (26%)
Tryp_SPc 32..256 CDD:238113 70/267 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457612
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.