DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP003627

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_562493.4 Gene:AgaP_AGAP003627 / 3290876 VectorBaseID:AGAP003627 Length:310 Species:Anopheles gambiae


Alignment Length:348 Identity:97/348 - (27%)
Similarity:146/348 - (41%) Gaps:63/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLSILLLVLGFSRIQALFCGGSMAKECVQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCCPK 67
            |:..::|||...|      .|.:|:||          |..|.|:    :|..:            
Mosquito     5 RVQCVVLVLVLCR------WGYIAQEC----------EEYRNIV----VNQSS------------ 37

  Fly    68 TEILQYPVQADNQPLPTE---CGHVNRIGVGFTITNARDIAQKGELPWMVALL-----DSRSRLP 124
                ..|:..:::|:..|   |.:|.::.||      .:.|:.||.|.. |||     |......
Mosquito    38 ----LVPLTINSKPIRFEVYNCSNVVQLIVG------GEQAKYGEFPHH-ALLGYPKKDGEKGYD 91

  Fly   125 -LGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENG 188
             |.||:||:...:||::....|...  :|||.||:|.:|.:.|....|  |..|.||.:......
Mosquito    92 FLCGGTLISNQHILTAAHCFNEGDP--VIVRVGEYDTKSESNEEYESD--ILSIRRHQDYLSTRS 152

  Fly   189 ANNAALLFLARPLKLDHHIGLICL-PPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVD 252
            .::.||:.|..|:.|..||...|| ....||.  .|.|.:|:|.......:...::.|:.|....
Mosquito   153 YHDIALVKLKYPIILSKHIRPACLWDTEERNI--TRYIATGFGYNETFGTTLSTVMMKVNLDEFP 215

  Fly   253 RSVCQTKLQG-PYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF 315
            .|.|:...:. |..:..:.|..| |.|. ..|:|||:||.|.||..........:.::||.:.|.
Mosquito   216 VSDCKRSFKSHPKFRQGVRDGQL-CVGSIVEGRDTCQGDSGGPLQVVTNPRSCSFAVVGITSIGG 279

  Fly   316 GCGGP-LPAAYTDVSQIRSWIDN 337
            .|||| ..|.||.||....||:|
Mosquito   280 VCGGPNAKAIYTKVSHYIDWIEN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/241 (32%)
Tryp_SPc 105..335 CDD:214473 74/239 (31%)
AgaP_AGAP003627XP_562493.4 Tryp_SPc 62..303 CDD:238113 79/255 (31%)
Tryp_SPc 62..300 CDD:214473 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.