DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG4653

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:114/256 - (44%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 IGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS------TKTLEVPEKY 150
            :||   :.::|..|:.|..|..::|  .|:.:.:.||:||....:||::      ......|.|.
  Fly    21 LGV---VQSSRLPAEVGSQPHSISL--RRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKS 80

  Fly   151 LIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVEN--GANNAALLFLARPLKLDHHIGLICLP 213
            ..||.|     ||......:.|.:.||:.|||.|..:  |:|:.|||.|...:.|:.:...|.| 
  Fly    81 YNVRVG-----SIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL- 139

  Fly   214 PPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG 278
            ...|....::.|.|||| .:.:|.|..::|:......:..|.|||:|       ::....|:|..
  Fly   140 ATERPAAGSQIIFSGWG-SSQVDGSLSHVLQVATRQSLSASDCQTEL-------YLQQEDLLCLS 196

  Fly   279 --GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF-GCGGPLPAAYTDVSQIRSWID 336
              .|.....|.||.|||.:       ...:|:||..|.. |||...|..|.||:|...||:
  Fly   197 PVDEDFAGLCSGDAGAPAS-------YNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWIN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/243 (29%)
Tryp_SPc 105..335 CDD:214473 69/240 (29%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/244 (29%)
Tryp_SPc 30..249 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457609
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.