DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG9673

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:112/258 - (43%) Gaps:48/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLT-----SSTKTLEVPEKYLIVRAGE 157
            |....|:|| ||.||..::..:::.  :..|::|:.:.:||     ||.....|....|.||.| 
  Fly    29 ILGGEDVAQ-GEYPWSASVRYNKAH--VCSGAIISTNHILTAAHCVSSVGITPVDASTLAVRLG- 89

  Fly   158 WDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPP-------- 214
                :|.:......|.::.::.|.  |..|..::.|:|.|...|.....|..|.|||        
  Fly    90 ----TINQYAGGSIVNVKSVIIHP--SYGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETED 148

  Fly   215 -----PNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSL 274
                 ||...::    |:|||:.:....||..  :|.....:.||:|:  .:..||.:     |:
  Fly   149 VDAELPNGTPVY----VAGWGELSDGTASYKQ--QKANYNTLSRSLCE--WEAGYGYE-----SV 200

  Fly   275 ICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFG-CGGPLPAAYTDVSQIRSWID 336
            :|.....|:..|:||.||.:.     |.::. |.|:.:|.|| ||...|...|.||...:||:
  Fly   201 VCLSRAEGEGICRGDAGAAVI-----DDDKV-LRGLTSFNFGPCGSKYPDVATRVSYYLTWIE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/251 (27%)
Tryp_SPc 105..335 CDD:214473 65/248 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 67/255 (26%)
Tryp_SPc 29..259 CDD:238113 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.