DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and plg

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_958880.2 Gene:plg / 322691 ZFINID:ZDB-GENE-030131-1411 Length:818 Species:Danio rerio


Alignment Length:296 Identity:82/296 - (27%)
Similarity:132/296 - (44%) Gaps:62/296 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSR 122
            |||.:...|.|:             |..|  ..||..|.       :::....||.:: |.:|.:
Zfish   570 CESLKCGQPATK-------------PKRC--FGRIVGGC-------VSKPHSWPWQIS-LRTRGK 611

  Fly   123 LPLGGGSLITRDVVLTSS--TKTLEVPEKYLIVRAGEWDFESITEERAHE----DVAIRKIVRHT 181
            :...||:||....|:|::  .:..:.|..|.|:.       .|..|||.|    :..:.||::..
Zfish   612 IHFCGGTLIDPQWVVTAAHCLERSDSPSAYKIML-------GIHTERATESSKQERDVTKIIKGP 669

  Fly   182 NLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFI---HNRCIVSGWGKKTALDNSYMNIL 243
                  ...:.|||.|.||..::..:..:||  |.:::|   :..|.|:|||:  ..|......|
Zfish   670 ------AGTDIALLKLDRPALINDKVSPVCL--PEKDYIVPSNTECYVTGWGE--TQDTGGEGYL 724

  Fly   244 KKIELPLVDRSVCQ--TKLQGPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRY 305
            |:...|:::..||.  :.|.|.     :.|:.: |||. |.|.|:|:||.|.||.|..|   |.:
Zfish   725 KETGFPVIENKVCNRPSFLNGR-----VKDHEM-CAGNIEGGNDSCQGDSGGPLVCYAQ---NTF 780

  Fly   306 ELLGIVNFGFGCGGPL-PAAYTDVSQIRSWIDNCIQ 340
            .|.|:.::|.||...: |..||.||:...||:..|:
Zfish   781 VLQGVTSWGLGCANAMKPGVYTRVSKFVDWIERSIK 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/244 (29%)
Tryp_SPc 105..335 CDD:214473 69/242 (29%)
plgNP_958880.2 PAN_AP_HGF 31..104 CDD:238532
KR 109..190 CDD:214527
KR 190..270 CDD:214527
KR 281..361 CDD:214527
Kringle 376..453 CDD:306546
KR 490..572 CDD:214527 1/1 (100%)
Tryp_SPc 589..813 CDD:238113 73/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.