DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:281 Identity:74/281 - (26%)
Similarity:126/281 - (44%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLIT 132
            |||.:  |.|: :.:...||...|:...:........|.|||.||..:|..:...  ..|.|||.
Mouse   157 TEISK--VDAE-KIINNRCGRRPRMSATYDRITGGSTAHKGEWPWQASLRVNGKH--YCGASLIG 216

  Fly   133 RDVVLTSS-----TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNA 192
            ...:||::     |..    .|.|.|..|    ..:|.  |:...::::|:.|.:.......::.
Mouse   217 ERFLLTAAHCFQGTNN----PKNLTVSFG----TRVTP--AYMQHSVQEIIIHEDYVKGEHHDDV 271

  Fly   193 ALLFLARPLKLDHHIGLICLP------PPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLV 251
            |::.|...:..::.:..:|||      ||...     .:|:|||..:....|.: :|:|..:.::
Mouse   272 AVIKLTEKVSFNNDVHRVCLPESTQIFPPGEG-----VVVTGWGSFSYNGKSPL-LLQKASIKII 330

  Fly   252 DRSVCQTKLQGPYGKDFILDNSLICAGGEPGK-DTCKGDGGAPLACPLQSDPNRYELLGIVNFGF 315
            |.:.|.:  :..||...:  ::::|||...|. |.|:||.|.||..|...|  .:.|:|||::|.
Mouse   331 DTNTCNS--EEAYGGRIV--DTMLCAGYLEGSIDACQGDSGGPLVHPNSRD--IWYLVGIVSWGH 389

  Fly   316 GCGG-PLPAAYTDVSQIRSWI 335
            .||. ..|..|..|:..|:||
Mouse   390 ECGRVNKPGVYMRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 66/244 (27%)
Tryp_SPc 105..335 CDD:214473 64/242 (26%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 64/249 (26%)
Tryp_SPc 185..413 CDD:238113 66/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.