DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG32376

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:214 Identity:59/214 - (27%)
Similarity:93/214 - (43%) Gaps:18/214 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 GGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANN 191
            |..:|.:..:||:.......|||| .||.|     |..:.|..:...::|||.....:.....::
  Fly    92 GCVIINKIWILTAHHCFFGPPEKY-TVRVG-----SDQQRRGGQLRHVKKIVALAAYNDYTMRHD 150

  Fly   192 AALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVC 256
            .|::.|..|:.....:..:.||.........:.:|||||..:|...:....|:::::..:.||.|
  Fly   151 LAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKC 215

  Fly   257 QTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP- 320
            | |:....|.....|  :||| ....||:|.||.|.||.       :|..|.|||::|.||... 
  Fly   216 Q-KMYKKAGLKIYKD--MICA-SRTNKDSCSGDSGGPLT-------SRGVLYGIVSWGIGCANKN 269

  Fly   321 LPAAYTDVSQIRSWIDNCI 339
            .|..|.:..:...||...|
  Fly   270 YPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 58/210 (28%)
Tryp_SPc 105..335 CDD:214473 56/208 (27%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 56/208 (27%)
Tryp_SPc 66..287 CDD:238113 58/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.