DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss30

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:296 Identity:87/296 - (29%)
Similarity:136/296 - (45%) Gaps:32/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS---TKT 143
            ||:.|||....|   .|...:| |.:|:.||.|:|..:... .:.|||||....|||::   .::
Mouse    61 LPSVCGHSRDAG---KIVGGQD-ALEGQWPWQVSLWITEDG-HICGGSLIHEVWVLTAAHCFRRS 120

  Fly   144 LEVPEKYLIVRAGEWDFESITEERAHED-VAIRKIVRH-TNLSVENGANNAALLFLARPLKLDHH 206
            |. |..|.:...|    .:::....|.. ||:|.|..| |.|..:..:.:.||:.|..||: ...
Mouse   121 LN-PSFYHVKVGG----LTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLR-PSQ 179

  Fly   207 IGLICLPPPNRNFIHNR-CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDF-- 268
            ...:|||.......... |.|:|||.....|.:  ::|:::.:||:|...|: |:....|...  
Mouse   180 FTPVCLPAAQTPLTPGTVCWVTGWGATQERDMA--SVLQELAVPLLDSEDCE-KMYHTQGSSLSG 241

  Fly   269 --ILDNSLICAGGEPG-KDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPL-PAAYTDVS 329
              |:.:.::|||...| ||:|:||.|.||.|.:.|.   :..:||.::|.||..|. |..||.|.
Mouse   242 ERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSS---WTQVGITSWGIGCARPYRPGVYTRVP 303

  Fly   330 QIRSWIDNCIQAEAVHYSPQLGNVGQSPAPLDRYIP 365
            ....||...:   |.::|...|....:.|.....:|
Mouse   304 TYVDWIQRIL---AENHSDAYGYHSSASAAYQMLLP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 74/243 (30%)
Tryp_SPc 105..335 CDD:214473 72/241 (30%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.