DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Tpsg1

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:128/274 - (46%) Gaps:34/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRD 134
            :|...|....||..:..|  :||..|..       ||.|..||..:|  ...::.:.||||::.:
  Rat    10 LLLLAVPGCGQPQVSHAG--SRIVGGHA-------AQAGAWPWQASL--RLQKVHVCGGSLLSPE 63

  Fly   135 VVLTSS-TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGAN-NAALLFL 197
            .|||:: ..:..|......|..||     :|...:.....:::|:.:::.....|:: :.||:.|
  Rat    64 WVLTAAHCFSGSVNSSDYEVHLGE-----LTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQL 123

  Fly   198 ARPLKLDHHIGLICLPPPNRNFIH--NRCIVSGWG---KKTALDNSYMNILKKIELPLVDRSVCQ 257
            |.|:.|...:..:|||..:.:| |  .:|.|:|||   :...|...|.  |::.::.:||...|.
  Rat   124 ATPVALSSQVQPVCLPEASADF-HPGMQCWVTGWGYTQEGEPLKPPYN--LQEAKVSVVDVETCS 185

  Fly   258 TKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-L 321
            .......|.  ::.:.::||.| || |.|:.|.|.||.|.:   ...::..|:|::|.|||.| .
  Rat   186 QAYSSSNGS--LIQSDMLCAWG-PG-DACQDDSGGPLVCRV---AGIWQQAGVVSWGEGCGRPDR 243

  Fly   322 PAAYTDVSQIRSWI 335
            |..|..|:...:||
  Rat   244 PGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/239 (28%)
Tryp_SPc 105..335 CDD:214473 65/237 (27%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 68/251 (27%)
Tryp_SPc 30..260 CDD:238113 69/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.