DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and HABP2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:316 Identity:96/316 - (30%)
Similarity:150/316 - (47%) Gaps:66/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TCCPKTEILQYPVQADNQP---LP--TECG-------HVNRIGVGFTITNARDIAQKGELPWMVA 115
            :.|...:: .||.::..:|   ||  ..||       .:.||..||..|       .|:.||..:
Human   274 SACSAQDV-AYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKST-------AGKHPWQAS 330

  Fly   116 LLDSRSRLPLG---------GGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHED 171
            |   :|.|||.         ||:||....|||::..| ::..::|.|..|:.|.:.  ||...:.
Human   331 L---QSSLPLTISMPQGHFCGGALIHPCWVLTAAHCT-DIKTRHLKVVLGDQDLKK--EEFHEQS 389

  Fly   172 VAIRKIVR--HTNLSVENGANNAALLFLARPLKLDHHIGL-------ICLPP---PNRNFIHNRC 224
            ..:.||.:  |.|...|...|:.|||.| :|  :|.|..|       :|||.   |:    .:.|
Human   390 FRVEKIFKYSHYNERDEIPHNDIALLKL-KP--VDGHCALESKYVKTVCLPDGSFPS----GSEC 447

  Fly   225 IVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG--EPGKDTCK 287
            .:||||.......|...:..|::  |:..::|.::..    .|.::|:|:||||.  :||:|||:
Human   448 HISGWGVTETGKGSRQLLDAKVK--LIANTLCNSRQL----YDHMIDDSMICAGNLQKPGQDTCQ 506

  Fly   288 GDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPLPAAYTDVSQIRSWIDNCIQAEA 343
            ||.|.||.|  :.| ..|.:.|||::|..| |..|..||.|::..:||...|::|:
Human   507 GDSGGPLTC--EKD-GTYYVYGIVSWGLEC-GKRPGVYTQVTKFLNWIKATIKSES 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 81/254 (32%)
Tryp_SPc 105..335 CDD:214473 79/252 (31%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056 0/2 (0%)
Tryp_SPc 314..553 CDD:238113 85/268 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.