DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Cela3b

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:279 Identity:75/279 - (26%)
Similarity:120/279 - (43%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ITNARDIAQKGELPWMVALLDSRSRLPLG------GGSLITRDVVLT-----SSTKTLEV----- 146
            :.|..| |.....||.|:|...:.    |      ||:||..|.|:|     |:::|.:|     
  Rat    28 VVNGED-AVPYSWPWQVSLQYEKD----GSFHHTCGGTLIAPDWVMTAGHCISTSRTYQVVLGEF 87

  Fly   147 -------PEKYLIVRAGE------WDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLA 198
                   ||:.:.|.||:      |                       |.:..:..|:.||:.|:
  Rat    88 ERGVEEGPEQVIPVNAGDLFVHPKW-----------------------NSNCVSCGNDIALVKLS 129

  Fly   199 RPLKLDHHIGLICLPP-----PNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQT 258
            |..:|...:.|.||||     ||    ...|.:|||| :.:.:....:.|::..||:||.:.| :
  Rat   130 RSAQLGDTVQLACLPPAGEILPN----GAPCYISGWG-RLSTNGPLPDKLQQALLPVVDYAHC-S 188

  Fly   259 KLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNF--GFGCGG-P 320
            |... :|  |.:..:::||||:. :..|.||.|.||.||.::  ..:::.|:.:|  ..||.. .
  Rat   189 KWDW-WG--FSVKKTMVCAGGDI-QSGCNGDSGGPLNCPAEN--GTWQVHGVTSFVSSLGCNTLK 247

  Fly   321 LPAAYTDVSQIRSWIDNCI 339
            .|..:|.||....||:..|
  Rat   248 KPTVFTRVSAFNEWIEETI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/268 (27%)
Tryp_SPc 105..335 CDD:214473 70/266 (26%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 72/273 (26%)
Tryp_SPc 28..265 CDD:238113 74/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.