DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss34

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:333 Identity:87/333 - (26%)
Similarity:139/333 - (41%) Gaps:73/333 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LQYPVQADNQPLPTECGH--VNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLP----LGGGS 129
            |..|......||..:.|.  |..:| |..::.:|       .||.|:|.....:|.    :.|||
  Rat    11 LTLPCLGSTMPLTPDSGQELVGIVG-GCPVSASR-------FPWQVSLRFYNMKLSKWEHICGGS 67

  Fly   130 LITRDVVLTSS--TKTLEVPEKYLIVRAGEWDFESITEERAHED---VAIRKIVRH----TNLSV 185
            ||....|||::  .:..|:......|:.|:.        |.:|:   :.:.||:||    ..||.
  Rat    68 LIHPQWVLTAAHCVELKEMEASCFRVQVGQL--------RLYENDQLMKVAKIIRHPKFSEKLSA 124

  Fly   186 ENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRC-IVSGWGKKTALDNSYMNI-----LK 244
            ..|| :.|||.|...:.|...:..:.||..::.....:. .|:|||    :...:..:     |:
  Rat   125 PGGA-DIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWG----VIEGHRPLPPPCHLR 184

  Fly   245 KIELPLVDRSVCQTKLQGPYGKD---FILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYE 306
            ::.:|:|..|.|:.|.:.....|   .|:.:.::|||.| |:|:|:.|.|.||.|.....   :.
  Rat   185 EVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCRWNCS---WV 245

  Fly   307 LLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVHYSPQLGNVGQSPAPLDRYIPNIGLE 370
            .:|:|::|.|||.| .|..||.|....|||..        |.|:.......|   ||        
  Rat   246 QVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHG--------YVPKFPEPSMGP---DR-------- 291

  Fly   371 TQNEVHSP 378
                :|:|
  Rat   292 ----IHTP 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/254 (28%)
Tryp_SPc 105..335 CDD:214473 69/252 (27%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 73/267 (27%)
Tryp_SPc 33..275 CDD:214473 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.