DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss29

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:262 Identity:68/262 - (25%)
Similarity:124/262 - (47%) Gaps:48/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQKGELPWMVALLDSR----SRLPLGGGSLITRDVVLTS-----------STKTLEVPEKYLIVR 154
            |.:|:.||.|:|...|    |.:.:.|||:|....|||:           |...:.:.:.||.  
  Rat    37 APQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQVYLY-- 99

  Fly   155 AGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF 219
            .||            :.:.:.:::.|.:.......::.|||.||:.::...::..:.|.|.:...
  Rat   100 GGE------------KLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEV 152

  Fly   220 I-HNRCIVSGWGKKT---ALDNSYMNILKKIELPLVDRSVCQ------TKLQGPYGKDFILDNSL 274
            . .:.|.|:|||..:   :|...|.  |:::::.:||.::|:      |:|.. :|:..||.: :
  Rat   153 TKKDVCWVTGWGSVSMHESLPPPYR--LQQVQVKIVDNTLCEKLYRNATRLSN-HGQRLILQD-M 213

  Fly   275 ICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWIDNC 338
            :|||.. |:|:|.||.|.||.|.:...   :.|:|:|::|:||. ..:|..|..|.....||...
  Rat   214 LCAGSH-GRDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQ 274

  Fly   339 IQ 340
            :|
  Rat   275 MQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/257 (26%)
Tryp_SPc 105..335 CDD:214473 65/255 (25%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.