DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG33226

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:114/266 - (42%) Gaps:61/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKY-LIVRAGEWDFESITEERA------ 168
            ||||.:|  :......|||||:...|||::    ....:| |.||.|.  :..||....      
  Fly    59 PWMVQIL--QRGYHFCGGSLISSLFVLTAA----HCHSRYRLKVRFGR--YSGITPRYLCSSQYC 115

  Fly   169 ---HEDVAIRKIVRHTNLSVENGAN-NAALLFLARPLKLDHHIGLIC-LPPPN----RNFIHNRC 224
               ..::.:::|..|:  |..:..| :.||..||:|::.:.....|| |...|    |.|::...
  Fly   116 SPFGPEIDVKRIFLHS--SYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVA 178

  Fly   225 I--VSGWGKKTALDNSYMNILKKIELPLVDRSVC----QTKLQGPYGKDFILDNSLICAGGEPGK 283
            :  |:||||..:...|  .||:...|..:||..|    ..|:..|:          ||| |....
  Fly   179 MFNVTGWGKTESQLTS--TILQTTSLFHLDRKFCAQIFDRKIGWPH----------ICA-GHSQS 230

  Fly   284 DTCKGDGGAPLACPLQ-SDPNRYELLGIVNFGFGCGGPLP-----AAYTDVSQIRSWIDNCIQAE 342
            .||.||.|.||:..|. |...|..|.||:::|      .|     ..:|:|.:..:||.:.:.  
  Fly   231 STCTGDSGGPLSAELTFSGVKRTVLFGIISYG------APNCREVTVFTNVLRYSNWIRDIVH-- 287

  Fly   343 AVHYSP 348
              :::|
  Fly   288 --NFTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/253 (28%)
Tryp_SPc 105..335 CDD:214473 70/251 (28%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 72/254 (28%)
Tryp_SPc 47..282 CDD:214473 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.