DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG33459

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:242 Identity:78/242 - (32%)
Similarity:113/242 - (46%) Gaps:36/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDF----ESITEERAHED 171
            ||| |.|.:..:. |.||||||.:.|||::...:..| |.|.||.||:|:    :||..:..|.:
  Fly    50 PWM-AFLHNHLQF-LCGGSLITSEFVLTAAHCVMPTP-KNLTVRLGEYDWTRQMDSINPKHRHRE 111

  Fly   172 VAIRKIVRHTNL-SVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIV--------S 227
            ..:.:|..|.:. |:  .|.:.|||.|.:.::....|..|||..| .||.....:|        :
  Fly   112 YMVTRIYTHPSYRSI--AAYDIALLKLNQTVEYTVAIRPICLVLP-ENFHEWYWLVDSVEDFTLT 173

  Fly   228 GWG-KKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGG 291
            ||| .||   .....:|:...|..:||..|..:    ||..  :|::.||||... ...|.||.|
  Fly   174 GWGATKT---EPVSQVLQSANLTQIDRGTCHDR----YGHS--VDHTHICAGSSK-SFACVGDSG 228

  Fly   292 APLACPLQSDPNRY--ELLGIVNFG-FGCGGPLPAAYTDVSQIRSWI 335
            :|||..:..: .||  ..:|||:.| ..|.|  ...:|:|.....||
  Fly   229 SPLAMKVVHN-RRYIHAQVGIVSRGPKNCDG--VTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/242 (32%)
Tryp_SPc 105..335 CDD:214473 76/240 (32%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 76/240 (32%)
Tryp_SPc 38..272 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.