DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Plau

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:400 Identity:98/400 - (24%)
Similarity:154/400 - (38%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CGGSMAKECVQRN----RCRIGTET-GRPIIDFR-------------------GLNNGNQGCESG 61
            |....:|.|...|    |.:..|:| |||.:.:.                   ||...|. |.:.
  Rat    62 CEIDTSKTCYHGNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHNY-CRNP 125

  Fly    62 QT-----CCPKTEILQYPVQA-------DNQPLPT------ECG------HVNRIGVGFTITNAR 102
            ..     |..:..:.|:..:.       ..:|..|      :||      ....:|..||:...:
  Rat   126 DNQRRPWCYVQIGLKQFVQECMVQDCSLSKKPSSTVDQQGFQCGQKALRPRFKIVGGEFTVVENQ 190

  Fly   103 DIAQKGELPWMVAL-LDSRSRLPLG---GGSLITRDVVLTSSTKTLEVP--EKYLI--------- 152
                    ||..|: |.::...|..   |||||:...|.:::...:..|  |:|::         
  Rat   191 --------PWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEYVVYLGQSKRNS 247

  Fly   153 VRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGA--NNAALLFL-------ARPLKLDHHIG 208
            ...||..||            :.:::.|.:.|.|..|  |:.|||.:       |:|.:.   |.
  Rat   248 YNPGEMKFE------------VEQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRT---IQ 297

  Fly   209 LICLPPPNRNF----IHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFI 269
            .|||||   .|    ..:.|.::|:|:::|.|..|...||...:.::....|  |....||.:  
  Rat   298 TICLPP---RFGDAPFGSDCEITGFGQESATDYFYPKDLKMSVVKIISHEQC--KQPHYYGSE-- 355

  Fly   270 LDNSLICAGGEPGK-DTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIR 332
            ::..::||.....| |:|.||.|.||.|.:...|.   |.|||::|.||... .|..||.||...
  Rat   356 INYKMLCAADPEWKTDSCSGDSGGPLICNIDGRPT---LSGIVSWGSGCAEKNKPGVYTRVSYFL 417

  Fly   333 SWIDNCIQAE 342
            :||.:.|..|
  Rat   418 NWIQSHIGEE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/261 (28%)
Tryp_SPc 105..335 CDD:214473 71/259 (27%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056 15/85 (18%)
Connecting peptide 152..178 4/25 (16%)
Tryp_SPc 178..420 CDD:214473 74/274 (27%)
Tryp_SPc 179..423 CDD:238113 76/276 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.