DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG30288

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:286 Identity:83/286 - (29%)
Similarity:117/286 - (40%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEV 146
            |..:||..:..|....|...||...:.. ||||.::.|..  .:.||||||...|||:...   :
  Fly    27 LENDCGTTSSNGYRARIDGGRDAGMESN-PWMVRVMISGK--AVCGGSLITARFVLTAEHC---I 85

  Fly   147 PEKYLIVRAGEWDF--------ESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKL 203
            ...|:.||.||:|.        :.:...||:.....|||| |:|...:.|     ||.:.|.:..
  Fly    86 SPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIV-HSNPGYDIG-----LLRMQRSVIF 144

  Fly   204 DHHIGLICLPPPNRNFIHNRCI-----------VSGWGKKTALDNSYMNILKKIELPLVDRSVCQ 257
            .:::..|||       |..:.:           .:|||  |..|....:.|:...|..:.:..|:
  Fly   145 SNYVRPICL-------ILGKTLGGNPLSILRFNFTGWG--TNSDGEEQDRLQTATLQQLPQWSCE 200

  Fly   258 TKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFG------ 316
            ..     |:.  ||.|.||||... .|:||||.|.||     |....:|..|.| |.||      
  Fly   201 RP-----GRP--LDISYICAGSYI-SDSCKGDSGGPL-----SAIRTFEGQGRV-FQFGVASQGL 251

  Fly   317 --CGGPLPAAYTDVSQIRSWIDNCIQ 340
              |.|  ...||:|:....||.:.||
  Fly   252 RLCSG--LGIYTNVTHFTDWILDVIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 74/258 (29%)
Tryp_SPc 105..335 CDD:214473 72/256 (28%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 75/264 (28%)
Tryp_SPc 45..270 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.