DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG30287

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:248 Identity:76/248 - (30%)
Similarity:108/248 - (43%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PWMVALLDSRSRLPLGGGSLITRDVVLT-----SSTKTLEVPEKYLIVRAGEWDFESITE----- 165
            ||||.::: |..:.. ||||||...|||     |.||:      .|.||.|::|.....:     
  Fly    54 PWMVIIIE-RGMMKC-GGSLITPRYVLTAAHCKSETKS------QLTVRLGDYDVNQAVDCSSYG 110

  Fly   166 --ERAHEDVAIRKIV--RHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPP----NRNFIHN 222
              .|..|....|..|  .:||..    .|:.|||.|...::...:|..|||...    :.|.:.|
  Fly   111 CIPRPREINVTRTYVPSHYTNFR----KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKN 171

  Fly   223 --RCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDT 285
              :...:|||:..:..||  .:|::..|.....|.|..    .:||.  ||.|.||.....| .|
  Fly   172 LVKFNTTGWGRTESRINS--PVLQQASLTHHHLSYCAQ----VFGKQ--LDKSHICVASSTG-ST 227

  Fly   286 CKGDGGAPLACPLQ-SDPNRYELLGIVNFG-FGCGGPLPAAYTDVSQIRSWID 336
            |:||.|.||...:: ....|..|.|:|::| ..|.|  |..||:|....:||:
  Fly   228 CQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG--PTVYTNVIHFANWIE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/248 (31%)
Tryp_SPc 105..335 CDD:214473 74/245 (30%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/245 (30%)
Tryp_SPc 42..280 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.