DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG30083

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:292 Identity:81/292 - (27%)
Similarity:129/292 - (44%) Gaps:42/292 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALL---DSRSRLPLGGGSLI 131
            ||.:| .|.:|.|...||:.:   :...|.:.:: |:.|..|||..:.   |......:.||:||
  Fly    10 ILLWP-GAMSQFLEPNCGYPD---ISPKIMHGQN-AENGTNPWMAYIFKYNDKEVAELVCGGTLI 69

  Fly   132 TRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLF 196
            .:..||:::.....  ::.|.||.|        |..:....|:.|..|:...:..:.:|:..:|.
  Fly    70 HKQFVLSAAHCIKR--DQILAVRLG--------EHSSSRYFAVTKAFRNKYFTTGSYSNDIGILR 124

  Fly   197 LARPLKLDHHIGLICL-----PPPN-RNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSV 255
            :...:|.:..|..||:     ..|| :.|     ..:||||..  :.::..:||.:||..::.|.
  Fly   125 IQPIVKFNAVIRPICIITDPTKVPNVKTF-----KAAGWGKTE--NETFSKVLKTVELNELNASE 182

  Fly   256 CQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPN-RYELLGIVNFGFG-CG 318
            |...|.      ..:..|.||| |.|..|||.||.|.||..|:..|.: ||..|||::||.. |.
  Fly   183 CYNMLW------VNVTESQICA-GHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCN 240

  Fly   319 GPLPAAYTDVSQIRSWIDNCIQAEAVHYSPQL 350
            .  |..||.:|....||...:....|...|::
  Fly   241 S--PGVYTRLSSFIDWILMVVDNYTVRSPPKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 70/242 (29%)
Tryp_SPc 105..335 CDD:214473 68/240 (28%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 69/248 (28%)
Tryp_SPc 34..255 CDD:238113 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.