DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG30082

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:276 Identity:80/276 - (28%)
Similarity:121/276 - (43%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPLPTECG------HVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLT 138
            |.:...||      ..|||..|.|       |..|..||: |.|...|.| :..|:|||:..|||
  Fly    22 QFIDPNCGTTINLPPTNRIVGGRT-------ADIGSNPWL-AYLHKNSSL-VCTGTLITKRFVLT 77

  Fly   139 SS--TKTLEVPEKYLIVRAGEWDFES---ITEE---RAHEDVAIRKIVRHTNL-SVENGANNAAL 194
            ::  ..:..:    |.||.||:|..:   .|.|   ..:|:.::.....||.. ..::..|:..|
  Fly    78 AAHCLHSFHL----LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGL 138

  Fly   195 LFLARPLKLDHHIGLICL-PPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQT 258
            |.|...:.....|..||| ..|.:....:....:||||...::.:  .:|:.:.|..:|:|.|:.
  Fly   139 LKLNGTVVYKLFIRPICLFRDPGQVPYSSTYEAAGWGKIDLINTA--TVLQTVNLIRLDQSDCER 201

  Fly   259 KLQG--PYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDP-NRYELLGIVNFG-FGCGG 319
            .|:.  .||:        .|| |:...|||.||.|.||:..:.:.. .|...||||::| :.|.|
  Fly   202 SLRTSLSYGQ--------FCA-GQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG 257

  Fly   320 PLPAAYTDVSQIRSWI 335
              |..||.|....:||
  Fly   258 --PGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/245 (29%)
Tryp_SPc 105..335 CDD:214473 70/243 (29%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 74/257 (29%)
Tryp_SPc 40..274 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.