DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Cela2a

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:286 Identity:88/286 - (30%)
Similarity:134/286 - (46%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVAL--LDSRSRLPLGGGSLITRDV 135
            |.||.|          |:|:..|       ..|.....||.|:|  |.|.......||||:..:.
  Rat    22 YEVQHD----------VSRVVGG-------QEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNW 69

  Fly   136 VLT-----SSTKTLEVPEKYLIVRAGEWDFESI-TEERAHEDVAIRKIVRHTNLSVE---NGANN 191
            |||     |:::|..|    |:.|      .|: |.|.....|.:.|:|.|...:.:   || |:
  Rat    70 VLTAAHCISNSRTYRV----LLGR------HSLSTSESGSLAVQVSKLVVHEKWNAQKLSNG-ND 123

  Fly   192 AALLFLARPLKLDHHIGLICLPP-----PNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLV 251
            .||:.||.|:.|...|...||||     || |:   .|.|:||| :...:.:..::|::..|.:|
  Rat   124 IALVKLASPVALTSKIQTACLPPAGTILPN-NY---PCYVTGWG-RLQTNGATPDVLQQGRLLVV 183

  Fly   252 DRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG-- 314
            |.:.|.:  ...:|..  :..:::||||:....:|.||.|.||.|  |:...::::.|||:||  
  Rat   184 DYATCSS--ASWWGSS--VKTNMVCAGGDGVTSSCNGDSGGPLNC--QASNGQWQVHGIVSFGST 242

  Fly   315 FGCGGP-LPAAYTDVSQIRSWIDNCI 339
            .||..| .|:.:|.||....||::.|
  Rat   243 LGCNYPRKPSVFTRVSNYIDWINSVI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 80/250 (32%)
Tryp_SPc 105..335 CDD:214473 78/248 (31%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 80/262 (31%)
Tryp_SPc 31..267 CDD:238113 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.