DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and F11

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:338 Identity:98/338 - (28%)
Similarity:148/338 - (43%) Gaps:54/338 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KECVQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLPTECGHVNR 91
            |.|....||:..|.|...    ...|.||:|     .|.         ::..:...||:..| .|
Human   319 KLCTNAVRCQFFTYTPAQ----ASCNEGNRG-----KCY---------LKLSSNGSPTKILH-GR 364

  Fly    92 IGV-GFTITNAR----------------DIAQKGELPWMVAL-LDSRSRLPLGGGSLITRDVVLT 138
            .|: |:|:...:                ..:.:||.||.|.| ..|.::..|.|||:|....:||
Human   365 GGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILT 429

  Fly   139 SS--TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPL 201
            ::  ...:|.| |.|.|.:|..:...|.|:.:.  ..:::|:.|....:.....:.|||.|...:
Human   430 AAHCFYGVESP-KILRVYSGILNQSEIKEDTSF--FGVQEIIIHDQYKMAESGYDIALLKLETTV 491

  Fly   202 KLDHHIGLICLPPP-NRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYG 265
            ........||||.. :||.|:..|.|:|||.: .|.:...|.|:|.::|||....||.:.:|   
Human   492 NYTDSQRPICLPSKGDRNVIYTDCWVTGWGYR-KLRDKIQNTLQKAKIPLVTNEECQKRYRG--- 552

  Fly   266 KDFILDNSLICAG-GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDV 328
              ..:.:.:|||| .|.|||.||||.|.||:|   .....:.|:||.::|.||. ...|..||:|
Human   553 --HKITHKMICAGYREGGKDACKGDSGGPLSC---KHNEVWHLVGITSWGEGCAQRERPGVYTNV 612

  Fly   329 SQIRSWIDNCIQA 341
            .:...||....||
Human   613 VEYVDWILEKTQA 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/237 (33%)
Tryp_SPc 105..335 CDD:214473 76/235 (32%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519 18/74 (24%)
Tryp_SPc 388..619 CDD:214473 76/242 (31%)
Tryp_SPc 389..619 CDD:238113 76/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.