DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Tmprss2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:460 Identity:108/460 - (23%)
Similarity:170/460 - (36%) Gaps:147/460 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALFCGG-SMAKECVQRNRC-RI-GT------------------------ETGRPIIDFRGLNN-- 53
            :|:|.| |........||| |: ||                        ..||......|..|  
  Rat   129 SLWCDGVSQCPNGEDENRCVRLYGTSFTLQVYSSQRKAWYPVCQDDWNESYGRAACKDMGYKNSF 193

  Fly    54 -GNQGC--ESGQTCCPKTEILQYPVQADNQPL-------------------PTECG-----HVNR 91
             .:||.  :||     .|..::..|.|.|..|                   ..|||     ..:|
  Rat   194 YSSQGIPDQSG-----ATSFMKLNVSAGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVRRQSR 253

  Fly    92 IGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVP---EKYLIV 153
            |..|.|       |..|:.||.|:|  ....:.:.|||:||.:.::|:: ..:|.|   .:|...
  Rat   254 IVGGST-------ASPGDWPWQVSL--HVQGIHVCGGSIITPEWIVTAA-HCVEEPLSSPRYWTA 308

  Fly   154 RAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRN 218
            .||......:.....|:   :.|::.|.|...:...|:.||:.|..||..:..:..:|||.|...
  Rat   309 FAGILKQSLMFYGSRHQ---VEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKPVCLPNPGMM 370

  Fly   219 F-IHNRCIVSGWGK-----KTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICA 277
            . :...|.:||||.     ||:      ::|....:||::.|.|.:|    |..:.::..::|||
  Rat   371 LDLAQECWISGWGATYEKGKTS------DVLNAAMVPLIEPSKCNSK----YIYNNLITPAMICA 425

  Fly   278 GGEPGK-DTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPL-PAAYTDVSQIRSWI----- 335
            |...|. |:|:||.|.||. .|:::  .:.|:|..::|.||.... |..|.:|:....||     
  Rat   426 GFLQGSVDSCQGDSGGPLV-TLKNE--IWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYQQMR 487

  Fly   336 -----------------------DNCIQAEAVHYSPQLGNVGQSPAPLDRYIPNIGLE-TQNEVH 376
                                   :.|..:|:.|:.                    ||: :....|
  Rat   488 VISLIPGLSMDCPWTCELKSQVREECTLSESGHFH--------------------GLDFSWVTFH 532

  Fly   377 SPVQG 381
            |||.|
  Rat   533 SPVPG 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 68/270 (25%)
Tryp_SPc 105..335 CDD:214473 66/240 (28%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060 5/17 (29%)
SRCR_2 152..247 CDD:292133 18/99 (18%)
Tryp_SPc 253..482 CDD:214473 70/254 (28%)
Tryp_SPc 254..485 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.