DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CTRB1

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:249 Identity:77/249 - (30%)
Similarity:122/249 - (48%) Gaps:25/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS---TKTLEVPEKYLIVRAGEWD 159
            |.|..| |..|..||.|:|.| ::.....|||||:.|.|:|::   .:|.:|      |.|||:|
Human    34 IVNGED-AVPGSWPWQVSLQD-KTGFHFCGGSLISEDWVVTAAHCGVRTSDV------VVAGEFD 90

  Fly   160 FESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF-IHNR 223
            ..|  :|...:.:.|.|:.::...|:....|:..||.||.|.:....:..:|||..:.:| ....
Human    91 QGS--DEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTL 153

  Fly   224 CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKG 288
            |..:||||.....|...:.|::..|||:..:.|:..    :|:.  :.:.:||||.. |..:|.|
Human   154 CATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKS----WGRR--ITDVMICAGAS-GVSSCMG 211

  Fly   289 DGGAPLACPLQSDPNRYELLGIVNFGFG-CGGPLPAAYTDVSQIRSWIDNCIQA 341
            |.|.||.|  |.| ..:.|:|||::|.. |....|..|..|:::..|:...:.|
Human   212 DSGGPLVC--QKD-GAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/236 (31%)
Tryp_SPc 105..335 CDD:214473 72/234 (31%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 75/241 (31%)
Tryp_SPc 34..259 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.