DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Tmprss3

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:292 Identity:79/292 - (27%)
Similarity:128/292 - (43%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QGCESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSR 120
            :||.||.....|.               :.||  .|.|....|... :::...:.||.|:|  ..
Mouse   214 EGCTSGHVVTLKC---------------SACG--TRTGYSPRIVGG-NMSSLTQWPWQVSL--QF 258

  Fly   121 SRLPLGGGSLITRDVVLTSSTKTLEV--PEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNL 183
            ....|.|||:||...::|::....::  |:.: .|:.|   ..|:.:......: :.||:.|:..
Mouse   259 QGYHLCGGSIITPLWIVTAAHCVYDLYHPKSW-TVQVG---LVSLMDSPVPSHL-VEKIIYHSKY 318

  Fly   184 SVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR-CIVSGWGKKTALDNSYMNILKKIE 247
            ..:...|:.||:.|:.||..|..|..||||....||...: |..|||| .|........:|....
Mouse   319 KPKRLGNDIALMKLSEPLTFDETIQPICLPNSEENFPDGKLCWTSGWG-ATEDGGDASPVLNHAA 382

  Fly   248 LPLVDRSVCQTKLQGPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRYELLGIV 311
            :||:...:|..:  ..||.  |:..|::|||. :.|.|:|:||.|.||.|   .:...::|:|..
Mouse   383 VPLISNKICNHR--DVYGG--IISPSMLCAGYLKGGVDSCQGDSGGPLVC---QERRLWKLVGAT 440

  Fly   312 NFGFGCGG-PLPAAYTDVSQIRSWIDNCIQAE 342
            :||.||.. ..|..||.::....||...::.:
Mouse   441 SFGIGCAEVNKPGVYTRITSFLDWIHEQLERD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/236 (29%)
Tryp_SPc 105..335 CDD:214473 67/234 (29%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 7/35 (20%)
Tryp_SPc 238..465 CDD:214473 68/242 (28%)
Tryp_SPc 239..468 CDD:238113 70/244 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.