DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and F9

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:441 Identity:105/441 - (23%)
Similarity:168/441 - (38%) Gaps:156/441 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FCGGSMAKECVQRNRCRI------------GTETGRPIIDFRG--------LNNG---------- 54
            |..|::.:||:: .||..            .||..:..:|  |        ||.|          
Mouse    55 FVRGNLERECIE-ERCSFEEAREVFENTEKTTEFWKQYVD--GDQCESNPCLNGGICKDDISSYE 116

  Fly    55 --------NQGCESGQTC--------------------CPKTEILQYPVQADNQ----PLPTECG 87
                    .:.||...||                    |..||  .|.:..|.:    .:|..||
Mouse   117 CWCQVGFEGRNCELDATCNIKNGRCKQFCKNSPDNKVICSCTE--GYQLAEDQKSCEPTVPFPCG 179

  Fly    88 HVNRIGVGFT---ITNARDI--------------------------------------------- 104
               |..:.::   ||.|..:                                             
Mouse   180 ---RASISYSSKKITRAETVFSNMDYENSTEAVFIQDDITDGAILNNVTESSESLNDFTRVVGGE 241

  Fly   105 -AQKGELPWMVAL---LDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEW--DFESI 163
             |:.|::||.|.|   :::     ..||::|....::|:: ..|:..:|..:| |||:  |.:..
Mouse   242 NAKPGQIPWQVILNGEIEA-----FCGGAIINEKWIVTAA-HCLKPGDKIEVV-AGEYNIDKKED 299

  Fly   164 TEERAHEDVAIRKIVRHT-NLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIH-----N 222
            ||:|.:   .||.|..|. |.::...:::.|||.|.:||.|:.::..||:  .||.:.:     .
Mouse   300 TEQRRN---VIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICV--ANREYTNIFLKFG 359

  Fly   223 RCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG-GEPGKDTC 286
            ...||||| |........:||:.:.:|||||:.|..      ...|.:.|::.||| .|.|||:|
Mouse   360 SGYVSGWG-KVFNKGRQASILQYLRVPLVDRATCLR------STTFTIYNNMFCAGYREGGKDSC 417

  Fly   287 KGDGGAPLACPLQSDPNRYELLGIVNFGFGCG--GPLPAAYTDVSQIRSWI 335
            :||.|.|....::...   .|.||:::|..|.  |.. ..||.||:..:||
Mouse   418 EGDSGGPHVTEVEGTS---FLTGIISWGEECAMKGKY-GIYTKVSRYVNWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/245 (31%)
Tryp_SPc 105..335 CDD:214473 74/243 (30%)
F9NP_032005.1 GLA 28..92 CDD:214503 8/37 (22%)
EGF_CA 93..129 CDD:238011 5/37 (14%)
FXa_inhibition 134..170 CDD:291342 6/37 (16%)
Tryp_SPc 236..464 CDD:214473 74/250 (30%)
Tryp_SPc 237..467 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.