DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and F2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_034298.1 Gene:F2 / 14061 MGIID:88380 Length:618 Species:Mus musculus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:124/265 - (46%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVP------EKYLIVRAGEWDFESI 163
            |:||..||.|.|.....:..|.|.|||:...|||::...|..|      |..|:||.|:   .|.
Mouse   367 AEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLVRIGK---HSR 428

  Fly   164 TE-ERAHEDVA-IRKIVRHTNLS-VENGANNAALLFLARPLKLDHHIGLICLPPPN------RNF 219
            |. ||..|.:: :.||..|...: .||...:.|||.|.:|:....:|..:|||...      |..
Mouse   429 TRYERNVEKISMLEKIYVHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAG 493

  Fly   220 IHNRCIVSGWGK-----KTALDNSYMNILKKIELPLVDRSVCQ--TKLQGPYGKDFILDNSLICA 277
            ...|  |:|||.     .|.::....::|:.:.||:|:|.||:  |:::       |.|| :.||
Mouse   494 YKGR--VTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIR-------ITDN-MFCA 548

  Fly   278 GGEPGK----DTCKGDGGAPLACPLQSDP--NRYELLGIVNFGFGCG--GPLPAAYTDVSQIRSW 334
            |.:...    |.|:||.|.|.   :...|  ||:..:|||::|.||.  |.. ..||.|.:::.|
Mouse   549 GFKVNDTKRGDACEGDSGGPF---VMKSPFNNRWYQMGIVSWGEGCDRKGKY-GFYTHVFRLKRW 609

  Fly   335 IDNCI 339
            |...|
Mouse   610 IQKVI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 83/261 (32%)
Tryp_SPc 105..335 CDD:214473 81/259 (31%)
F2NP_034298.1 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
KR 213..295 CDD:214527
Thrombin_light 313..360 CDD:286482
Tryp_SPc 360..610 CDD:214473 81/259 (31%)
Tryp_SPc 361..613 CDD:238113 83/262 (32%)
High affinity receptor-binding region which is also known as the TP508 peptide. /evidence=ECO:0000250 548..570 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.