DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP001366

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_321777.4 Gene:AgaP_AGAP001366 / 1281814 VectorBaseID:AGAP001366 Length:563 Species:Anopheles gambiae


Alignment Length:375 Identity:86/375 - (22%)
Similarity:137/375 - (36%) Gaps:81/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KECVQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQADN-----QPL--PT 84
            ::.:...|....|.|.|||.:.|..|..:|.....:...|...:...|:.||.     .|:  .|
Mosquito   200 RQRIANRRITTTTTTYRPIAEERIWNQPSQRSIPSEPTSPPKRVSTVPLIADKGFTTLAPIARST 264

  Fly    85 ECGHVNR------------------IG------------VGFTITNAR------DIAQKGELPWM 113
            ..|..||                  .|            .|..:..|.      .::::|:.||.
Mosquito   265 TAGGTNRDQYFAGDYAFLQHESTPKAGQTHYINKYEGDICGTVVPKANPLVTHGTVSERGQFPWH 329

  Fly   114 VALLDSRSRLP----LGGGSLITRDVVLTSS-TKTLEVPEK-----YLIVRAGEWDFESITEERA 168
            .||.  ||.:.    |.|.:||:|...:|:: ..|||...|     .|::..|:.|...  ....
Mosquito   330 GALY--RSTVTELKYLCGATLISRRASITAAHCVTLEKSSKPVDAGSLLLYFGKIDLSK--WNGP 390

  Fly   169 HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICL---PPPNRNFIHNRCIVSGWG 230
            .||..||.|........|...|:.|:|.|...:|..:.:..:||   ....:..|:....|.|||
Mosquito   391 EEDAQIRSIHIPAQYQHERFFNDIAVLVLKEDIKYSNFVRPVCLWNFDDDYKTLINKIGFVPGWG 455

  Fly   231 -KKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDF---ILDNSLICAGGEPGKDTCKGDGG 291
             .:..|.:|.::.   .::|:|....|...     .:||   :..::..|||.:.|...|.||.|
Mosquito   456 YNEHGLVSSRLSF---AQMPVVAHETCIWS-----NRDFFSKVTSDTSFCAGFKNGTSVCNGDSG 512

  Fly   292 APLACPLQSDPNRYELLGIVNFG------FGCGGPLPAAYTDVSQIRSWI 335
            ..:   :....|.:.|.|||:..      |.|.......:||.::..|||
Mosquito   513 GGM---VFKHNNLWYLRGIVSVSAALQDRFHCDSKHYVVFTDAAKFTSWI 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 65/254 (26%)
Tryp_SPc 105..335 CDD:214473 63/252 (25%)
AgaP_AGAP001366XP_321777.4 GD_N 15..124 CDD:292649
Tryp_SPc 315..560 CDD:238113 65/260 (25%)
Tryp_SPc 315..559 CDD:214473 63/258 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.