DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CLIPD7

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_319747.4 Gene:CLIPD7 / 1279958 VectorBaseID:AGAP008998 Length:413 Species:Anopheles gambiae


Alignment Length:403 Identity:97/403 - (24%)
Similarity:148/403 - (36%) Gaps:110/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CVQRNR---CRIG----TETGRPIIDFRGLNNGNQGCESGQ---TCC------------------ 65
            ||.:|:   ||:.    .|.||.:          .||...:   :||                  
Mosquito    31 CVYQNQVRTCRLSFSCWLEGGRHV----------SGCGENRWLMSCCVYDNEQSSAVLAPKVAYA 85

  Fly    66 ----PKTEILQ--YPVQADNQPLP----------------------------------------- 83
                |...:||  .||...|..:|                                         
Mosquito    86 GPMVPMVPVLQPIVPVNRPNMLVPPQSFTKKKSFFHRRSDQLMQASIIILINSNWSTINSKPLLH 150

  Fly    84 --TECG--HVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTL 144
              .|||  ..::..:...|...| .|...|.||...:..:..:.   ||.|::|..|.|::....
Mosquito   151 PQNECGIPQTSQNTLQKRIIGGR-TANFAEYPWQAHIRIAEYQC---GGVLVSRRFVATAAHCIQ 211

  Fly   145 EVPEKYLIVRAGEWDFES---ITEERAHEDVAIRKIVRHTNL---SVENGANNAALLFLARPLKL 203
            :...|.:::..||.|.::   |.|....|...:...:.|...   ..:....:.|||.|.||...
Mosquito   212 QARLKDILIYLGELDTQNSGKIVEPLPAEKHRVEMKIVHPKFIFRMTQPDRYDLALLKLTRPAGY 276

  Fly   204 DHHIGLICLPPPNRNFIHNRCIVSGWGKKTA-LDNSYMNILKKIELPLVDRSVCQTKLQGPYGKD 267
            ..||..||||......:..:.|::||||..| :..:..|||:...:|::....|   |:....|:
Mosquito   277 KSHILPICLPMRPLELVGRKGIIAGWGKTNANMGQTGTNILRTAAVPIISTKEC---LRWHSSKN 338

  Fly   268 FILD--NSLICAGGEPG-KDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDV 328
            ..::  |.:.|||...| :|.|.||.|.||   :.:|..||.|:||.:.||||| ...|..|.:|
Mosquito   339 INVELFNEMFCAGHSDGHQDACLGDSGGPL---IINDRGRYTLIGITSAGFGCGVDHQPGIYHNV 400

  Fly   329 SQIRSWIDNCIQA 341
            .:...||.:.|.|
Mosquito   401 QKTIKWIQSVIYA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/242 (29%)
Tryp_SPc 105..335 CDD:214473 69/240 (29%)
CLIPD7XP_319747.4 Tryp_SPc 168..407 CDD:214473 71/248 (29%)
Tryp_SPc 169..410 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.