DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP004149

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_313033.3 Gene:AgaP_AGAP004149 / 1273976 VectorBaseID:AGAP004149 Length:543 Species:Anopheles gambiae


Alignment Length:340 Identity:95/340 - (27%)
Similarity:149/340 - (43%) Gaps:62/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYPVQA----------------DNQPLPTECG 87
            |.|.:|::      ..|:..|:  |..|.||..|.|..|                .:||:     
Mosquito   217 TTTRQPVL------GSNRLAET--TPLPTTEPPQPPTTAIPTTTELLTTVLPTVVPDQPM----- 268

  Fly    88 HVNRIGVGFTITNARDIAQK----GELPWMVALL---DSRSRLPLG-GGSLIT-RDVVLTSSTKT 143
             :|....|.:: |.|.|..:    |:.|||..|.   .:..|:... .||||| |.|:..:...|
Mosquito   269 -INAPLCGLSV-NTRIIGGETEVPGQFPWMARLAYRNQTSGRVTYRCAGSLITNRHVITVAHCVT 331

  Fly   144 LEVPEKYLI-VRAGEWDFESITEERA---HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLD 204
            ..:.|..|: :|.|:.:..::|:.|.   ::|.||.:|:.|.:..|...||:.||:.|....:..
Mosquito   332 NLIDELQLVSIRLGDLECNAVTDPRCSARYQDFAIEQIIPHESYDVPKYANDIALIKLRETTETY 396

  Fly   205 HHIGLICLP-----PPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPY 264
            :.|..:|||     |...|......|::|||..:...|:....|:.:.||:||.:.|    ...|
Mosquito   397 NIISPLCLPTDQYAPYALNLTGQLGIIAGWGSTSNRSNTPSPTLQWLRLPIVDTAGC----ANAY 457

  Fly   265 GK-------DFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG-FGCG-GP 320
            .:       ..|:..:.:||.|:..:|.|:||.|.||.....|..:|:.|||:|:|| ..|| ..
Mosquito   458 ARYSVNSRNPIIVSGNQMCAQGQENRDACQGDSGGPLMNEAISTRDRFVLLGLVSFGPRTCGVSN 522

  Fly   321 LPAAYTDVSQIRSWI 335
            .|..||.:|....||
Mosquito   523 FPGVYTRISAYIDWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 76/258 (29%)
Tryp_SPc 105..335 CDD:214473 74/256 (29%)
AgaP_AGAP004149XP_313033.3 CLIP 47..92 CDD:288855
Tryp_SPc 281..537 CDD:214473 76/259 (29%)
Tryp_SPc 282..537 CDD:238113 75/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.