DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CLIPA8

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_311445.2 Gene:CLIPA8 / 1272532 VectorBaseID:AGAP010731 Length:369 Species:Anopheles gambiae


Alignment Length:350 Identity:115/350 - (32%)
Similarity:174/350 - (49%) Gaps:51/350 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LFCGGSMAKECVQRNRCRIGTETGRPIIDFRGLNNGNQG-----------CES-GQTCCPKTEIL 71
            |.|.|..   |..:..|..||        :...|..||.           |:. .|.||.....:
Mosquito    40 LECPGGF---CSPKYLCPNGT--------YNEANAQNQEIIMLRFGEEDVCQDYMQVCCSNATSM 93

  Fly    72 QYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDS------RSRLPLGGGSL 130
            :|.:..:|:|:...||..|..|:.:.:...|..||.||.||:||:|::      :....:|||:|
Mosquito    94 RYELVTNNEPVEYGCGISNPGGLIYQVEGNRTYAQYGEFPWVVAILEAFYSSNEQQFTYVGGGTL 158

  Fly   131 ITRDVVLTSS---TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAI-RKIVRHTNLSVENGANN 191
            |....|:|::   .||     :.|:...||||..........:::.| |.|:.|...:.....|:
Mosquito   159 IHPRFVVTAAHIFNKT-----ENLVASFGEWDMNRDENVYPKQNIDIDRTIIVHPEYNSVGLLND 218

  Fly   192 AALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVC 256
            .||..|.:.:..|.||..||||.|...|....||.:|||.: ||.::|.|:||:::||::.|:.|
Mosquito   219 IALAQLKQNVVYDKHIRPICLPNPTDRFDDQLCISTGWGIE-ALTSAYANVLKRVDLPVIARASC 282

  Fly   257 -----QTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFG 316
                 :|:| ||:   |.|..|::|||||.|.|.|.||||:.||||.:|  ..|.|.|||::|..
Mosquito   283 KKLFAETRL-GPF---FRLHKSVLCAGGEEGADMCDGDGGSGLACPNES--GAYVLAGIVSWGLS 341

  Fly   317 CGGP-LPAAYTDVSQIRSWIDNCIQ 340
            |... :|.||.:|::..:||:..|:
Mosquito   342 CHQQNVPGAYVNVARFVTWINATIE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 92/247 (37%)
Tryp_SPc 105..335 CDD:214473 90/245 (37%)
CLIPA8XP_311445.2 Tryp_SPc 127..364 CDD:238113 92/248 (37%)
Tryp_SPc 127..361 CDD:214473 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.