DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:160 Identity:49/160 - (30%)
Similarity:73/160 - (45%) Gaps:24/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 HTNLSV--ENGANNAALLFLARPLKLDHHIGLICLPPP----NRNFIHNRCIVSGWGKKTALDNS 238
            ||....  ::.||:.||:...||:.....:..||||..    |||.:......:||||..:...|
Mosquito     2 HTGYDTKDQSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRNHVGMPAYAAGWGKTESATAS 66

  Fly   239 YMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPN 303
            ...:  |:|:.:.....|....|   ....:|..:.:||||..|||||.||.|.||   ::....
Mosquito    67 EKKL--KVEMNIKSLQECAPVYQ---RGGILLKQTHMCAGGVRGKDTCSGDSGGPL---MRQMTG 123

  Fly   304 RYELLGIVNFG------FGCGGPLPAAYTD 327
            .:.|:|:|:||      ||    :|..||:
Mosquito   124 SWYLIGVVSFGPQKCGTFG----VPGVYTN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 49/160 (31%)
Tryp_SPc 105..335 CDD:214473 49/160 (31%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473 48/158 (30%)
Tryp_SPc <1..149 CDD:238113 48/158 (30%)
Tryp_SPc 261..>389 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.