DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss29

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:114/272 - (41%) Gaps:68/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQKGELPWMVALLDSRSRLPLG----GGSLITRDVVLTS-----------STKTLEVPEKYLIVR 154
            |.:|:.||.|:|...|......    |||:|....|||:           |...:.|.|.||.  
Mouse    37 APQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLY-- 99

  Fly   155 AGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLA---------RPLKLDHHIGLI 210
             |..:..|::....|.|..      |..|     .::.|||.||         :|:||       
Mouse   100 -GGKELLSVSRVIIHPDFV------HAGL-----GSDVALLQLAVSVQSFPNVKPVKL------- 145

  Fly   211 CLPPPNRNFIHNR---CIVSGWGKKT---ALDNSYMNILKKIELPLVDRSVCQTKLQGP-----Y 264
                |:.:....:   |.|:|||..:   :|...|.  |:::::.::|.|:|:......     .
Mouse   146 ----PSESLEVTKKDVCWVTGWGAVSTHRSLPPPYR--LQQVQVKIIDNSLCEEMYHNATRHRNR 204

  Fly   265 GKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDV 328
            |:..|| ..::|||.: |:|:|.||.|.||.|.:...   :.|:|:|::|:||. ...|..|..|
Mouse   205 GQKLIL-KDMLCAGNQ-GQDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCALRDFPGVYARV 264

  Fly   329 SQIRSWIDNCIQ 340
            .....||...:|
Mouse   265 QSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/267 (27%)
Tryp_SPc 105..335 CDD:214473 69/265 (26%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 71/268 (26%)
Tryp_SPc 31..271 CDD:214473 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.