DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss28

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:255 Identity:62/255 - (24%)
Similarity:111/255 - (43%) Gaps:42/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GELPWMVAL----LDSRSRLPLGGGSLITRDVVLTS-----------STKTLEVPEKYLIVRAGE 157
            |:.||.|:|    .:..|.:.:.|||:|....:||:           :...::|.|.||.     
Mouse    40 GKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLY----- 99

  Fly   158 WDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF-IH 221
                     :..|.:.|.:|:.|.:.:..:...:.||:.|...|....::..:.||..:..| ..
Mouse   100 ---------KEQELLNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDST 155

  Fly   222 NRCIVSGWG---KKTALDNSYMNILKKIELPLVDRSVCQ---TKLQGPYGKDFILDNSLICAGGE 280
            ::|.:.|||   ::..|...|.  |.::::|:.|...|:   .|......|...:.:.::|| |.
Mouse   156 DQCWLVGWGNLLQRVPLQPPYQ--LHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCA-GT 217

  Fly   281 PGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPLPAAYTDVSQIRSWIDNCIQ 340
            .|:..|.||.|.||.|   ...|::..:|:|:.|..|...||:.::.|....:||...||
Mouse   218 SGRGPCFGDSGGPLVC---WKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHIQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 60/250 (24%)
Tryp_SPc 105..335 CDD:214473 58/248 (23%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 60/251 (24%)
Tryp_SPc 31..269 CDD:214473 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.