DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CTRC

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:154 Identity:40/154 - (25%)
Similarity:69/154 - (44%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PWMVAL--LDSRSRLPLGGGSLITRDVVLT-----SSTKTLEVPEKYLIVRAGEWDFESITEERA 168
            ||.::|  |.:.:.....||:||..:.|||     |:|:|..       |..|:.:.| :.:|..
Human    42 PWQISLQYLKNDTWRHTCGGTLIASNFVLTAAHCISNTRTYR-------VAVGKNNLE-VEDEEG 98

  Fly   169 HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPN----RNFIHNRCIVSGW 229
            ...|.:..|..|...:.....|:.||:.||..::|...|.:.|||..:    :::   .|.|:||
Human    99 SLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKDSLLPKDY---PCYVTGW 160

  Fly   230 GKKTALDNSYMNILKKIELPLVDR 253
            |:      .:..:....|||:.:|
Human   161 GR------LWRGLRWPTELPVGER 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 40/154 (26%)
Tryp_SPc 105..335 CDD:214473 40/154 (26%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 36/137 (26%)
Tryp_SPc 30..>173 CDD:238113 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.