DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:291 Identity:82/291 - (28%)
Similarity:129/291 - (44%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG------GGSLITRDVVLTS 139
            |....||    |.:|..:.:.:. .|..|.|| .||::.:.  |.|      |||||....::|:
Mosquito    43 PESPHCG----IQLGDRVLSGQS-TQIDEFPW-TALIEFQK--PDGSFGFHCGGSLINDRYIVTA 99

  Fly   140 STKTLEVPEKYLI--VRAGEWDFESITE------ERAHEDVAIRKIVRHTNLSV--ENGANNAAL 194
            :.....:|..:.:  ||.||||..|..:      ..|..|:.|.:||.||....  ::.||:.||
Mosquito   100 AHCIKSIPRDWKVQRVRLGEWDLTSANDCQNEFCSDAPIDLDIEQIVVHTGYDTKDKSNANDIAL 164

  Fly   195 LFLARPLKLDHHIGLICLPPPN--RNFIHNRCI--VSGWGKKTALDNSYMNILKKIEL------- 248
            :...||:.....:..||||..:  ||..|:..|  ..||.|..:...|...:..::|:       
Mosquito   165 IRFTRPVNYSQTVRPICLPLSSSLRNRSHDGLISYEVGWRKTNSATASEKKLKVEVEIKSLQECA 229

  Fly   249 PLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNF 313
            |:.:|:            ..:|..:.:||||...||||.|:.|.||   ::.....:.|:|:.:|
Mosquito   230 PIYERN------------GILLKQTHMCAGGVRSKDTCSGNSGGPL---MRQMTGSWYLIGVNSF 279

  Fly   314 G------FGCGGPLPAAYTDVSQIRSWI-DN 337
            |      ||    :|..||:|::...|| ||
Mosquito   280 GPRKCGTFG----VPDVYTNVAEYVDWIKDN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/265 (28%)
Tryp_SPc 105..335 CDD:214473 73/262 (28%)
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 73/270 (27%)
Tryp_SPc 59..306 CDD:238113 75/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.