DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and AgaP_AGAP013452

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_003435969.1 Gene:AgaP_AGAP013452 / 11175626 VectorBaseID:AGAP013452 Length:379 Species:Anopheles gambiae


Alignment Length:300 Identity:78/300 - (26%)
Similarity:127/300 - (42%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CG----HVNRIGVGFTITNARDIAQK---GELPWMVALLDSRSRL--PLGGGSLITRDVVLTSS- 140
            ||    |.|.:.:|         .||   |:.||...::......  .:.|||:|.:..:||:: 
Mosquito    30 CGVRKVHYNNLILG---------GQKAPAGKWPWHAIIVHRAGDTVQAVCGGSIIDKYTILTAAH 85

  Fly   141 ---TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLK 202
               |....:....|.|..|.... |:.::|:....|.|.|| ||..|..:..::.||:.:.:.::
Mosquito    86 CLYTTHGVIARNRLQVYVGRTQL-SVIDDRSRSYSAERFIV-HTGYSQLHVRDDIALIKVTKEIE 148

  Fly   203 LDHHIGLICL----PPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGP 263
            :...|..:||    |....:.:..|..|.|:| .|.:|.. .:::...|:|:||...|....:..
Mosquito   149 MSAFIQPVCLWPSEPISGTDIVGRRGAVVGFG-LTDVDKP-SDVMLDAEVPVVDLWSCLESNRAA 211

  Fly   264 YGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPLP------ 322
            :||.  |..:::||||..|...|.||.|..|...:   ...:.:.|||:|.....|.|.      
Mosquito   212 FGKH--LARTMLCAGGRDGVGPCNGDSGGGLFLEI---GGVWYVRGIVSFAPNLDGVLKCDFTQY 271

  Fly   323 AAYTDVSQIRSWIDNCIQAEAVHYSPQLGNVGQSPAPLDR 362
            ..:|||::...||     |||.      || |...:|:.|
Mosquito   272 TVFTDVAKYLDWI-----AEAD------GN-GTLVSPMRR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 65/250 (26%)
Tryp_SPc 105..335 CDD:214473 63/248 (25%)
AgaP_AGAP013452XP_003435969.1 Tryp_SPc 41..286 CDD:238113 66/267 (25%)
Tryp_SPc 41..284 CDD:214473 64/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.