DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:273 Identity:71/273 - (26%)
Similarity:115/273 - (42%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS 140
            ||.:.|....||.:.......|:......|.  ..||..:|.....:  ..|||||.::.|| |:
Zfish   287 QALDSPSAAVCGIIPVNSSNGTVGGQNSSAV--HWPWQASLYWYSGQ--TCGGSLINKEWVL-SA 346

  Fly   141 TKTLEVPEK--YLIVRAG-----EWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLA 198
            .........  ||.|..|     ::|...|:.       :::.:::|...:.....|:.||:.|:
Zfish   347 AHCFNGQRNGFYLTVILGPKTQNKYDPSRISR-------SVKAVIKHPYYNPNTNDNDIALVRLS 404

  Fly   199 RPLKLDHHIGLICLPPPNRNF-IHNRCIVSGWGKKTALDNSYM---NILKKIELPLVDRSVCQTK 259
            .|:.....|..:||......| ......::.|  :...|...:   .|.:::|:|::....|...
Zfish   405 FPITFTDSIRPVCLAAEGSVFNSDTESWITTW--RNISDGVPLPSPKIFQEVEVPVIGNRQCNCL 467

  Fly   260 LQGPYGKDFILDNSLICAG-GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLP 322
                ||...|.|| :|||| .:.|||.|:||.|.|:   :.:..:.:...|||:||.||. ...|
Zfish   468 ----YGVGSITDN-MICAGLLKEGKDLCQGDSGGPM---VSNQSSVWVQSGIVSFGSGCAQSEFP 524

  Fly   323 AAYTDVSQIRSWI 335
            ..||.||:.:.||
Zfish   525 GVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 65/244 (27%)
Tryp_SPc 105..335 CDD:214473 63/242 (26%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 63/249 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.