DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and gzma

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:256 Identity:65/256 - (25%)
Similarity:115/256 - (44%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 HVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLI 152
            |:|. .:...|.:.|:.|.... |:|..:.   ||....||:||.::.|||::...:...|..| 
 Frog    26 HING-NICMDIIDGREAASHSR-PYMAYIY---SRTGSCGGTLIKQNWVLTAAHCVVNNSEVIL- 84

  Fly   153 VRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNR 217
               |....:|  .|...:..::.:.:.|.....:...::..||.:....||:..:.::.||..:.
 Frog    85 ---GAHKVKS--RENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDM 144

  Fly   218 NF-IHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEP 281
            :. ..:.|..:|||.......:..::|:::.:.:|||..| .|:...:..:  :..:::|||. |
 Frog   145 DVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTC-NKIYKKFKTE--ISTNMLCAGA-P 205

  Fly   282 GK-----DTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDV-SQIRSWI 335
            .|     |.|:||.|.||.|       ..|..|||:||..||.| .|..||.: ::...||
 Frog   206 KKSDKKYDACQGDSGGPLIC-------GKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 61/239 (26%)
Tryp_SPc 105..335 CDD:214473 59/237 (25%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.