DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Gm10334

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:277 Identity:78/277 - (28%)
Similarity:129/277 - (46%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVL 137
            :||..|           ::|..|:|       .|:..:|:.|:|   .|.....|||||....|:
Mouse    16 FPVDDD-----------DKIVGGYT-------CQENSVPYQVSL---NSGYHFCGGSLINDQWVV 59

  Fly   138 TSS--TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARP 200
            :::  .||      .:.||.||.:...:  |...:.|...||::|.|.:.:...|:..|:.|:.|
Mouse    60 SAAHCYKT------RIQVRLGEHNINVL--EGNEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSP 116

  Fly   201 LKLDHHIGLICLP----PPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQ 261
            :.|:..:..:.||    |..     .:|::||||...:...|..::|:.::.||:.::.|:....
Mouse   117 VTLNARVATVALPSSCAPAG-----TQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASYP 176

  Fly   262 GPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAA 324
            |.      :..:::|||. |.|||:|:||.|.|:.|       ..||.|||::|:||..| .|..
Mouse   177 GK------ITGNMVCAGFLEGGKDSCQGDSGGPVVC-------NGELQGIVSWGYGCALPDNPGV 228

  Fly   325 YTDVSQIRSWIDNCIQA 341
            ||.|.....||.:.|.|
Mouse   229 YTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 70/239 (29%)
Tryp_SPc 105..335 CDD:214473 68/237 (29%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.