DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and LOC100004427

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:237 Identity:62/237 - (26%)
Similarity:108/237 - (45%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAH 169
            |.:|..||..::....:......||||:...|||:::....:....:::..|.     :|...::
Zfish    42 ATEGSWPWQASINFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIYLGR-----LTTNGSN 101

  Fly   170 EDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIH-NRCIVSGWGKKT 233
            .....|.:::   :||   ..:.||:.|:..:....:|..:||......|:. ....|:|||..:
Zfish   102 PYEIPRTVIQ---VSV---TEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESWVTGWGSTS 160

  Fly   234 ALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG--GEPGKDTCKGDGGAPLAC 296
            :.:....::||::|.|:|:...| :.:.|...    ||| :||||  .|.||..|..|.|:||  
Zfish   161 STNVILSDMLKEVEAPIVNNIEC-SNINGITN----LDN-VICAGFVNETGKAPCWEDFGSPL-- 217

  Fly   297 PLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWIDN 337
             :....:::...|:|.|.| || ...|..|..||:...||.|
Zfish   218 -VTRQGSQWIQSGVVVFTF-CGQNGFPTLYARVSEYEEWIRN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 61/235 (26%)
Tryp_SPc 105..335 CDD:214473 59/233 (25%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 59/233 (25%)
Tryp_SPc 36..257 CDD:238113 61/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.